Protein Info for AMB_RS22050 in Magnetospirillum magneticum AMB-1

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 90 to 117 (28 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details amino acids 235 to 260 (26 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 376 to 401 (26 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 18 to 391 (374 residues), 160.6 bits, see alignment E=2.4e-51

Best Hits

Swiss-Prot: 55% identical to Y326_METJA: Putative permease MJ0326 (MJ0326) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to mag:amb4359)

MetaCyc: 48% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ12 at UniProt or InterPro

Protein Sequence (432 amino acids)

>AMB_RS22050 NCS2 family permease (Magnetospirillum magneticum AMB-1)
MLQRLFDLSGHRTSLRTECLAGATTFLTMAYIIFVNPAMLAEAGMDKGAVFVATCLAAAL
GSAAMGLLANYPIALAPGMGLNAYFTYGVVIGMGVPWPVALGAVFVSGVLFLVLALTRVR
EAIINAVPQSLKLAISAGIGLFLGLIAFESAGLVEGHKATLVTLGHLGRPEPLLAAAGFV
AMVGLEARRVPGAIMIGILGTAAAGMALGVTPFGGIAAWPPSLAPTFLKMDVAGALNLGL
VTIVFALLFVDLFDNAGTLIGLAHRAGMLDARGRLPRLGRALIADSLAAMAGGALGTSTT
TSYIESASGINAGGRTGLAAVVTGLLFAAALFLAPLAAAIPAYATAPALLFVACLMARSL
ADIAWDDVTEAVPAVVTALAMPFTFSIAHGISLGFITFAAVKLLGGKARDVGPAVWLLAG
AFVLKFVLLGSV