Protein Info for AMB_RS22035 in Magnetospirillum magneticum AMB-1

Annotation: membrane protein insertase YidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 352 to 367 (16 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details amino acids 442 to 465 (24 residues), see Phobius details amino acids 502 to 519 (18 residues), see Phobius details amino acids 539 to 560 (22 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 4 to 375 (372 residues), 341.1 bits, see alignment E=1.2e-105 PF14849: YidC_periplas" amino acids 87 to 366 (280 residues), 275.5 bits, see alignment E=7.9e-86 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 376 to 574 (199 residues), 228.2 bits, see alignment E=8.7e-72 PF02096: 60KD_IMP" amino acids 377 to 574 (198 residues), 207.1 bits, see alignment E=1.7e-65

Best Hits

Swiss-Prot: 52% identical to YIDC_METNO: Membrane protein insertase YidC (yidC) from Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 100% identity to mag:amb4356)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ15 at UniProt or InterPro

Protein Sequence (579 amino acids)

>AMB_RS22035 membrane protein insertase YidC (Magnetospirillum magneticum AMB-1)
MNDQRNLFVAIAISVAILIGWQYFFPTAKPPVEQAAQQQSAEQKASAPATAPTPATASSP
AQVPGSPAAAAAQPAATRADALGKSRRIAIQTPSMHGSIALTGARIDDITLVKYRETPAA
DSREIDLMSPAESPEPYWAEFGWVATEANVKVPGPDSVWQAQGSGPLTPASPLVLTWDNG
EGLRFVRTYTVDENYMFGVAQRVENYGTKPASLHPYALLARTGTPHVAGMYILHEGPLGV
FDGTLKEMKYDDLKKEGSSRHKTTGGWAGITDKYWLTALVPPAKTEITGRFVHQRLGNAD
RYQVDYLAPARMIEPGKSEEAGFHLFTGAKQVSLLDGYAEKFGIDRFDLAIDFGWFYFLT
KPFFYLLQMLHSALGNMGLAILALTVILKLAMFPLANKSYVAMGKMKKLQPKVQELQARY
ADDKMRLQQEMMALYKTEKVNPVSGCLPIMVQIPVFFALYKVLFVTIEMRHAPFYGWISD
LSAQDPTNIFTLFGMIPWTPPSMFHLGVWPLIMGVTMFLQQKLNPQPTDPVQAKMMQFLP
IIFTFLLANFASGLVIYWAWSNTLSILQQWVIMKRAEEK