Protein Info for AMB_RS21885 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to LOLD_GEOMG: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)

KEGG orthology group: K02003, (no description) (inferred from 70% identity to rru:Rru_A3651)

MetaCyc: 47% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"ABC transporter ATP-binding protein YvcR"

MetaCyc Pathways

lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>AMB_RS21885 ABC transporter (Magnetospirillum magneticum AMB-1)
MHQRPIAGLPLVSLEAVHLNLASLAGEVNVLDGIDLQVASGETLGVVGPSGSGKSTLLMV
MAGLERPTSGKVAVAGQDFGPMDEDGLARFRRDSIGIVFQSFHLIPTMTALENVAVPLEL
AGHADPFGAAQEELGRVGLAHRLSHYPGQLSGGEQQRVALARAFVPRPKLLLADEPTGNL
DGATGRAVMDLLFDLNARFGTALVLVTHDDSLAARCTRVVRVEDGKIKP