Protein Info for AMB_RS21875 in Magnetospirillum magneticum AMB-1

Annotation: BAX inhibitor (BI)-1/YccA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 24 to 50 (27 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details PF01027: Bax1-I" amino acids 16 to 225 (210 residues), 225.7 bits, see alignment E=2.6e-71

Best Hits

KEGG orthology group: K06890, (no description) (inferred from 100% identity to mag:amb4324)

Predicted SEED Role

"FIG005935: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ47 at UniProt or InterPro

Protein Sequence (231 amino acids)

>AMB_RS21875 BAX inhibitor (BI)-1/YccA family protein (Magnetospirillum magneticum AMB-1)
MSAAQAEAAQIDVGLRQYMLSVYNYMASALALTGIVAWVIASVPALTAIAVYSPLKWVFM
LAPLGLVFFMGAKIDSMRASTASTLFWVYAGLMGASLASVFLVFTGASVARVFFVTAAAF
AGLSLYGYTTKKDLSGFGSFLIMGVWGLMIAGIVNIFLQSPMMHFVMSAAGVLIFAGLTA
YDTQNIKQMYWEGDHSEVAQKKAVFGALQLYMDFINLFMFLLQFMGVRRDD