Protein Info for AMB_RS21770 in Magnetospirillum magneticum AMB-1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 79 (18 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 120 to 148 (29 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 225 to 228 (4 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details amino acids 335 to 351 (17 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 392 to 440 (49 residues), see Phobius details amino acids 447 to 468 (22 residues), see Phobius details amino acids 490 to 512 (23 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 36 to 515 (480 residues), 393.7 bits, see alignment E=1.4e-121 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 54 to 510 (457 residues), 254.3 bits, see alignment E=9.8e-80 PF03600: CitMHS" amino acids 75 to 444 (370 residues), 97 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 57% identical to MEMP_CUPNH: Membrane protein (H16_A0667) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 100% identity to mag:amb4305)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ66 at UniProt or InterPro

Protein Sequence (517 amino acids)

>AMB_RS21770 membrane protein (Magnetospirillum magneticum AMB-1)
MGNVGMVCRGAPGKGGNLMAESKAVTPVEGVSGRTEILGLGVALAALVAIILLPLPAGLH
PAGLRMMAIMVFAVIIWMTEAVPYAVSAAVIVSLIALALGLGPALADPTKLMGSSKALGM
ALSGFSNTAFALVAGAMFISAAMMITGLDKRIALVILSRLGARTGRVLAGVIFTGFALSF
LVPSTTARVSCMVPIVMGIIVAFGVDRRSRFAAVLMIATAQADSLWNVGIKTAAAQNMIA
VSFIEKQLHYSVSWLEWFVAAAPFSAVMSVILYFLLMKLLPPEVDEIEGGKATIAAKLAE
LGPMTAGEKKLLTISLILLCFWTTEKVLHDFDTSTTTMVAITLMLVPRIGVMDWKDAQAR
IGWGTLILFGVGISLGQCLLDTGAASWMAKYIVATFGMENFPAIGIVAVLALFLIVVHLG
FASATGLAAAMIPIIIAVLQSIKTPGINIVGMTMIAQYVVSFGFILPVNAPQNMVVYCTE
TFQSKDFIRTGIPLTIIAYIMILVMSATYWRWLGLTG