Protein Info for AMB_RS21670 in Magnetospirillum magneticum AMB-1

Annotation: thioredoxin TrxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 2 to 101 (100 residues), 115.8 bits, E=1.2e-37
• TIGR01068: thioredoxin
  • amino acids 5 to 102 (98 residues), 125.7 bits, E=3.6e-41
• PF13098: Thioredoxin_2
  • amino acids 19 to 99 (81 residues), 31.9 bits, E=2.1e-11
• PF13905: Thioredoxin_8
  • amino acids 19 to 60 (42 residues), 30.8 bits, E=4.5e-11

Best Hits

Swiss-Prot: 77% identical to THIO_RHORU: Thioredoxin (trxA) from Rhodospirillum rubrum

KEGG orthology group: K03671, thioredoxin 1 (inferred from 100% identity to mag:amb4286)

MetaCyc: 62% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

No annotation

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (6/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

See Q2VZ85 at UniProt or InterPro

Protein Sequence (104 amino acids)

>AMB_RS21670 thioredoxin TrxA (Magnetospirillum magneticum AMB-1)
MKIVTDSSFEAEVLKAPGPVLVDFWAEWCGPCRQIAPALEELSKDRADKITIAKINIDEN
PGTPGKYGVRGIPTLMIFKNGQVAATKIGALPKSKLYEWVDSSL