Protein Info for AMB_RS21505 in Magnetospirillum magneticum AMB-1

Annotation: DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 11 to 607 (597 residues), 792 bits, see alignment E=3.5e-242 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 12 to 463 (452 residues), 508.2 bits, see alignment E=2.2e-156 PF00270: DEAD" amino acids 25 to 181 (157 residues), 81.3 bits, see alignment E=1.8e-26 PF00271: Helicase_C" amino acids 238 to 331 (94 residues), 58.9 bits, see alignment E=1.4e-19 PF16124: RecQ_Zn_bind" amino acids 343 to 405 (63 residues), 74.8 bits, see alignment E=1.8e-24 PF09382: RQC" amino acids 408 to 515 (108 residues), 131.1 bits, see alignment E=4.4e-42 PF00570: HRDC" amino acids 540 to 606 (67 residues), 76.5 bits, see alignment E=3.1e-25

Best Hits

Swiss-Prot: 50% identical to RECQ_SALTY: ATP-dependent DNA helicase RecQ (recQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to mag:amb4254)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZB7 at UniProt or InterPro

Protein Sequence (620 amino acids)

>AMB_RS21505 DNA helicase RecQ (Magnetospirillum magneticum AMB-1)
MTGIFMPLPLHILKTVFGFPAFRGQQEEVIRHVVEGGDALVLMPTGAGKSLCYQVPALCR
DGVAIVVSPLIALMQNQVEALTQLGVRAAALNSARSPDEARVIERRMQAGELDLVYVAPE
RLVLPGFLSLLEDCRIALFAIDEAHCVSQWGHDFRPEYLQLALLHERFPAVPRIALTATA
DGPTRRDIAERLNLQDGRQFVAGFDRPNIRYRIAAKNNAREQLARFIEAEHGGPGADSGI
VYCLSRAKVEETAAWLAGKGYTALAYHAGLDQSVRAGNQERFLREDGIVMVATIAFGMGI
DKPDVRFVAHLDLPKSLEAYYQETGRAGRDGQPADAWMAYGLEDVAKLGQFIASSQASDA
QKRIEWQKLNALLGLCETTRCRRQVLLEYFGETDHPPCGNCDTCLEPIASFDGTELARKA
LSCVYRTGESFGAGHVIDVLLGKDNDKVRRFGHERLSTFGIGTELPAEQWRSVLRQLVAA
GLLSIDTEGHGAFKLTEACRPVLRSEVRVDLRRDPLPARGKSKSSGGKKTAIALSEPGDE
ALFQHLRAERVALAKAQGVPSYVIMHDATLLEVARRRPRQPGDLADIPGLGEAKRERYGQ
ILLDAVAAFEAQDAGEGKRR