Protein Info for AMB_RS21440 in Magnetospirillum magneticum AMB-1

Annotation: carbonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 40 to 192 (153 residues), 183.4 bits, E=1.8e-58

Best Hits

Swiss-Prot: 54% identical to CAN_SHIFL: Carbonic anhydrase 2 (can) from Shigella flexneri

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 100% identity to mag:amb4241)

MetaCyc: 54% identical to carbonic anhydrase 2 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• superpathway of the 3-hydroxypropanoate cycle (13/18 steps found)
• cyanate degradation (2/3 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• glyoxylate assimilation (9/13 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (1/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (7/14 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See Q2VZD0 at UniProt or InterPro

Protein Sequence (219 amino acids)

>AMB_RS21440 carbonate dehydratase (Magnetospirillum magneticum AMB-1)
MSKVPGIDRLLANNKAWAEETERTKPGFFAHLAEQQTPGYLWIGCADSRVPANEIVGLEP
GEVFVHRNVANQVHHADMNCLAVLQYAIDVLKVEHIIVCGHYGCGGVRAALQDARLGVTE
YWIRPVRDICECHRHELDMLPNEAAQVDRLCELNVMQQVRNLCRSPVIQDAWQRGQQLEV
HSWVYGLTDGLVRTLGPTVAGLKSLDEFGASYLMRGAAF