Protein Info for AMB_RS20980 in Magnetospirillum magneticum AMB-1

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 151 to 170 (20 residues), see Phobius details PF12146: Hydrolase_4" amino acids 31 to 117 (87 residues), 40.8 bits, see alignment E=1.6e-14 PF00561: Abhydrolase_1" amino acids 44 to 117 (74 residues), 33.2 bits, see alignment E=4.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4148)

Predicted SEED Role

"Hydrolases of the alpha/beta superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZM3 at UniProt or InterPro

Protein Sequence (310 amino acids)

>AMB_RS20980 alpha/beta hydrolase (Magnetospirillum magneticum AMB-1)
MVMEPISLLCRDGYELLGHFWRPEGAVDAGTVIINPATGVLARYYHRYARFLAEQGFAVL
TYDYRGIGLSRPGRIQGAGIRWRDWGELDFDAAIAWAQRRRPDGMLAVVGHSIGGFLPGF
APGAARIDRLLTVGAQYAYWRDYAADRRLRLMLKWHVAMPVLTALLGYFPGRRLGWLEDL
PAGVAHEWSFRREKMEVSYPQHERPLILDRFAAVRAQILAVGMADDEFGTPRAILRGLSY
YRNSERQRVSLAPADLGFADVGHFGLFHARHRDGFWRQSCAWLRDGLSPWPPDAVLLPEG
GTWKQRISYA