Protein Info for AMB_RS20855 in Magnetospirillum magneticum AMB-1

Annotation: DNA recombination protein RmuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02646: RmuC" amino acids 134 to 420 (287 residues), 243.6 bits, see alignment E=1.2e-76

Best Hits

Swiss-Prot: 48% identical to RMUC_XYLFT: DNA recombination protein RmuC homolog (rmuC) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 100% identity to mag:amb4124)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZP7 at UniProt or InterPro

Protein Sequence (442 amino acids)

>AMB_RS20855 DNA recombination protein RmuC (Magnetospirillum magneticum AMB-1)
MDFALISAALSLLALIGVAVLLLRKKDDLSERLDRLERVLRDEARQDRRETAEMIRTFQG
DSAASADKNHTELRILVETKLAEFRSDQATQARALREEVLGGIKQLGEGIGKTVAEQTRV
VSEHLEKLRGENTQKLEQMRQTVDEKLQGTLEKRLGESFKLVSDRLEQVHKGLGEMQSLA
SGVGDLKRVLTNVKTRGTWGEVQLGALLEQIFRADQYMREANCKKGSLERVDFAIRLPGK
GDDEPEVLLPIDSKFPNEDYERLQLAVERADPDAVEAAAKGLETRVKSFARDIRDKYVNP
PTTTDFAILFLPTEGLYAEVLRRPGLVDLIQRDYKVIAAGPTTLGAILNAIQMGFKTMAI
EKRSSEVWEILGAVKTEFGKYGDVLDKVQKKLQEASKTIDDVAVRKRAIDRQLRKVEAIP
DAGVEALLALGATTIDDTGEDE