Protein Info for AMB_RS20840 in Magnetospirillum magneticum AMB-1

Annotation: S-methyl-5'-thioadenosine phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01694: methylthioadenosine phosphorylase
  • amino acids 10 to 247 (238 residues), 301.8 bits, E=1.5e-94
• PF01048: PNP_UDP_1
  • amino acids 10 to 247 (238 residues), 156.3 bits, E=4.3e-50

Best Hits

Swiss-Prot: 70% identical to MTAP_RHORT: S-methyl-5'-thioadenosine phosphorylase (mtnP) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00772, 5'-methylthioadenosine phosphorylase [EC: 2.4.2.28] (inferred from 100% identity to mag:amb4121)

MetaCyc: 70% identical to S-methyl-5'-thioadenosine phosphorylase monomer (Rhodospirillum rubrum)

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28)" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

• S-methyl-5'-thioadenosine degradation II (1/1 steps found)
• 5'-deoxyadenosine degradation I (2/3 steps found)
• L-methionine salvage cycle III (3/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.28

Sequence Analysis Tools

See Q2VZQ0 at UniProt or InterPro

Protein Sequence (295 amino acids)

>AMB_RS20840 S-methyl-5'-thioadenosine phosphorylase (Magnetospirillum magneticum AMB-1)
MADGHSTPVLGIIGGSGVYDIDGLTSKEWRRVESPFGPTSDEFLFGELNGQKLVFLPRHG
RGHRIPPSELNFRANIDAMKRAGVTEILSVSAVGSLKEELPPGTFVIVDQFIDRTFARTK
SFFESGLVAHISMAHPVCGRLGDLVEAAAREAGIIAVRGGTYLVMEGPQFSTLAESNLYR
QWGCDVIGMTNMPEAKLAREAEMCYASVAMVTDYDCWHPDHDAVTVDAIVKVLLANADRA
RSLVKAVTPKVSGRNSPCAKGCHTALDNAIITHGEVRDPAVVGKLDAVAGRVLKG