Protein Info for AMB_RS20830 in Magnetospirillum magneticum AMB-1

Annotation: peptide-methionine (R)-S-oxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR00357: methionine-R-sulfoxide reductase" amino acids 13 to 134 (122 residues), 187 bits, see alignment E=7.3e-60 PF01641: SelR" amino acids 22 to 135 (114 residues), 174.2 bits, see alignment E=4.3e-56

Best Hits

Swiss-Prot: 66% identical to MSRB_BRADU: Peptide methionine sulfoxide reductase MsrB (msrB) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 100% identity to mag:amb4119)

MetaCyc: 50% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZQ2 at UniProt or InterPro

Protein Sequence (137 amino acids)

>AMB_RS20830 peptide-methionine (R)-S-oxide reductase (Magnetospirillum magneticum AMB-1)
MTGMVTMTDKVVKTEAEWQAQLSPGQYAVTRQKATERPFSGQYDHHFQPGKYACVCCGQE
LFLSEAKFNSGCGWPAFSMPAAPQAVTEERDRSHGMIRTEVLCSRCDAHLGHVFDDGPGP
TGLRYCINSLSLKFEAP