Protein Info for AMB_RS20810 in Magnetospirillum magneticum AMB-1

Annotation: tRNA pseudouridine(55) synthase TruB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 10 to 219 (210 residues), 235.3 bits, see alignment E=2.9e-74 PF01509: TruB_N" amino acids 32 to 180 (149 residues), 181.7 bits, see alignment E=1.2e-57 PF16198: TruB_C_2" amino acids 181 to 239 (59 residues), 45.9 bits, see alignment E=5e-16

Best Hits

Swiss-Prot: 58% identical to TRUB_RHORT: tRNA pseudouridine synthase B (truB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 100% identity to mag:amb4115)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZQ6 at UniProt or InterPro

Protein Sequence (311 amino acids)

>AMB_RS20810 tRNA pseudouridine(55) synthase TruB (Magnetospirillum magneticum AMB-1)
MARKRKGDPVNGWLAIDKPLGIGSTQVVAKVKRLLNAAKVGHGGTLDPLASGILPIALGE
ATKTVQYVMDGSKTYRFQVRWGEATASCDRESEVIETSPHRPTAEAIAAALPAFLGEIDQ
IPPAYSAIKIDGQRAYDLARAGEEVEIKPRRVAIKSFTLLGQPDADHADFEVHCGKGTYV
RSLARDLSLALGTVGHVSVLRRIACGPFNEQNAISLESLEDLSQVPAPWTFLLPIETALD
DIPALALTESEARRLQSGNPVSISHVVSRHPQAELAEGTVCRAMQAERLVALVRIESGEI
RPVRVMNLTEE