Protein Info for AMB_RS20750 in Magnetospirillum magneticum AMB-1

Annotation: YbaB/EbfC family nucleoid-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 103 (101 residues), 107.1 bits, see alignment E=2.4e-35 PF02575: YbaB_DNA_bd" amino acids 8 to 98 (91 residues), 126.1 bits, see alignment E=2.5e-41

Best Hits

Swiss-Prot: 100% identical to Y4104_MAGSA: Nucleoid-associated protein amb4104 (amb4104) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K09747, hypothetical protein (inferred from 100% identity to mag:amb4104)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZR7 at UniProt or InterPro

Protein Sequence (107 amino acids)

>AMB_RS20750 YbaB/EbfC family nucleoid-associated protein (Magnetospirillum magneticum AMB-1)
MKNLGNLMKQAQQMQSKMAEMQATMAEMEVTGSSGAGMLQVTLNGKYELKKVKIDPSLVD
PSDVEVLEDLILAAFNDAKAKAEAAMAEEMAKMTGGLNLPPGFKLPF