Protein Info for AMB_RS20520 in Magnetospirillum magneticum AMB-1

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02321: OEP" amino acids 59 to 254 (196 residues), 42.1 bits, see alignment E=4.3e-15 amino acids 286 to 464 (179 residues), 39.8 bits, see alignment E=2.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4059)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZW2 at UniProt or InterPro

Protein Sequence (494 amino acids)

>AMB_RS20520 outer membrane protein (Magnetospirillum magneticum AMB-1)
MKGVSVRRGFRNAVLGVSTAALLSACSVMPEDLAEIREEINRHAQSLPQEMLKRPLSVED
AMKLAVAHNLDARVKELEEVLAAGKADMSLFAMLPELAAKGRWSKRGPRKLTTSKDVGTG
AISNDYSTGEDVIGRTGDLTASWNLVDFGIALVRSDQEEDKVVLAAEKRRRAQHLLLQDV
QAAYWKAVINEFANRKYRSLESRLVKSVEDAETAERTKVGDPMQMLGHQRAIVDTMRQIA
ELQRQTSTAKADLAGHMGMPSASAFELAELKDDSFLSAEDPDSSVEAMEAVALANRPELK
SEEVQFRIDRNEIRTELLKTLPGIGPFMGGHYDSNSFIKYNAWADAGAHMAWNLMDIVSA
PKRISNAQNTAETTRTRRLAMGMAVLTQVHVADIQVRHALKEYRLTEQMAAIDRRISGLA
AKSKQAGSGSAMEEIKAEASGMLSTLRRFILYSDLQGAKARLKAAQGIDHAPPSETFTDT
PPPETTADAAPHAG