Protein Info for AMB_RS20515 in Magnetospirillum magneticum AMB-1

Annotation: ABC protease/lipase transporter ATPase/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 transmembrane" amino acids 132 to 153 (22 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 136 to 399 (264 residues), 65.4 bits, see alignment E=6.8e-22 PF00005: ABC_tran" amino acids 464 to 611 (148 residues), 100 bits, see alignment E=1.8e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4058)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZW3 at UniProt or InterPro

Protein Sequence (672 amino acids)

>AMB_RS20515 ABC protease/lipase transporter ATPase/permease (Magnetospirillum magneticum AMB-1)
MLPPTPVELEGLDDKARAVSACLRAMGHAVAATALKDSYRMATADAAEAPWITALSRYGF
AAHVEDGVNPAKLSADLFPCVVLGPGEPRALVMAPPEGQPGRLLFMRPRLDRADSVQPTS
WTAMLASWKPMVVRAGLAGMLANFLALAAPIFSAQVYDRVLPHGLLNSLAVMVLMFLGAA
LFEQVFRRLRALFVEDALHEGNIRLAMDMHRRILETRFDGAAAPSGHLMRMLQDFDAIRD
GLGAAAVSLLADLPFMGLFLLGLFLCDPLIALAVLGLNLAVALGTLLAIHRQKLLYKELS
GAASQRAQAAQESFSDPETVRRVGAAAYLQARFRHGTALYAATARAIRTLSAARGNISML
AQNMALLLAVGLGAWRAVEGGMSAGVILAATMLATRFTGAAMQMVSVVPQALSAVASLEA
LRTVTGRPTERPAGSALIHRPVSRGGLMVEAVTAGYPGAFNPALDGISLDLEPGGRLAVI
GPSGSGKTTLEKVLSGIIRPVSGRVLLDGVDIALIDPADLRRHLGICPQTPPLYSGSLRN
NLCFDGLVSDEQMIAMMNMLGAGGVMPMGMGLDFQVVEGGRNLSGGQRQIVALARTLLRG
AAVTILDEPTAFLDEASEKRAIAGIHQAVGNRSLVVISHRPAVVALAAKVARLDRGKLLD
VTRRAPPAPAGG