Protein Info for AMB_RS20210 in Magnetospirillum magneticum AMB-1

Annotation: ATP synthase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 211 to 241 (31 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 4 to 244 (241 residues), 215.1 bits, see alignment E=6.3e-68 PF00119: ATP-synt_A" amino acids 31 to 240 (210 residues), 211.7 bits, see alignment E=6.1e-67

Best Hits

Swiss-Prot: 100% identical to ATP6_MAGSA: ATP synthase subunit a (atpB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 100% identity to mag:amb3993)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W028 at UniProt or InterPro

Protein Sequence (247 amino acids)

>AMB_RS20210 ATP synthase subunit A (Magnetospirillum magneticum AMB-1)
MANPIEQFKIQPLVPLKVGSVDISFTNSSAMMVLSICLITLFLTLSVRSRALVPGRWQSM
AEVFYEFIAGMLRDNVGQEGRKYFPFIFSLFMFVLFGNLLGMMPIPVIGFTYTSHVIVTF
AMALVVFVGVTVIGFARHGTHYLRMFFPHGAPIATAVILIPIELISYFSRPFSLAVRLFA
NMTVGHIILKVMGGFVVSLGAFYLIPGAVPFAFLSAITVLEFGIALLQAYVFTILSCIYL
HDAIHMH