Protein Info for AMB_RS20110 in Magnetospirillum magneticum AMB-1

Annotation: histidinol-phosphate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR01141: histidinol-phosphate transaminase" amino acids 7 to 359 (353 residues), 295.1 bits, see alignment E=3.1e-92 PF00155: Aminotran_1_2" amino acids 29 to 356 (328 residues), 180.6 bits, see alignment E=8e-57 PF00266: Aminotran_5" amino acids 65 to 189 (125 residues), 21.8 bits, see alignment E=1.3e-08 PF01041: DegT_DnrJ_EryC1" amino acids 82 to 156 (75 residues), 21.8 bits, see alignment E=1.6e-08

Best Hits

Swiss-Prot: 100% identical to HIS8_MAGSA: Histidinol-phosphate aminotransferase (hisC) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 100% identity to mag:amb3974)

Predicted SEED Role

"Biosynthetic Aromatic amino acid aminotransferase beta (EC 2.6.1.57)" in subsystem Phenylalanine and Tyrosine Branches from Chorismate (EC 2.6.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.9

Use Curated BLAST to search for 2.6.1.57 or 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W047 at UniProt or InterPro

Protein Sequence (363 amino acids)

>AMB_RS20110 histidinol-phosphate aminotransferase (Magnetospirillum magneticum AMB-1)
MTAPAPRPGIMDIRPYVGGESAIEGVDRILKLSSNEGALGPSPKAMEALRAMAPEMHRYP
DGGAEDLRKAIGARFGLDASRIVCGAGSDELLGILCRAYAGPGDEVLYSAHGFLMYAIAA
KACGATPVTAPEVDLTANVDNLLAAVTPRTKILFLANPNNPTGTYLPATEVARLRAGLRA
DILLVIDAAYTEFVSRNDYSGGIELVEAGDNVVVCRTFSKMYALGGLRLGWAYCPENVAG
VLNRVRNPFNVGAPALAAGLAAFNDTAYAELCKSHNDYWLPWLSGQLAELGLTVVPSVCN
FILVRFPKDAGKDAGAADKFLRSKGIIVRAMGGYGLGDCLRITIGTGEENQLVVAALKEF
VGA