Protein Info for AMB_RS19985 in Magnetospirillum magneticum AMB-1

Annotation: MaoC family dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 68% identical to MCH_CHLAA: Beta-methylmalyl-CoA dehydratase (mch) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K14449, mesaconyl-CoA hydratase (inferred from 70% identity to rrs:RoseRS_4172)

MetaCyc: 68% identical to beta-methylmalyl-CoA dehydratase monomer (Chloroflexus aurantiacus)
RXN-8960 [EC: 4.2.1.148]

Predicted SEED Role

"Mesaconyl-CoA hydratase"

MetaCyc Pathways

methylaspartate cycle (14/19 steps found)
superpathway of the 3-hydroxypropanoate cycle (13/18 steps found)
glyoxylate assimilation (9/13 steps found)
ethylmalonyl-CoA pathway (7/11 steps found)
crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (5/14 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.148

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>AMB_RS19985 MaoC family dehydratase (Magnetospirillum magneticum AMB-1)
MTKTNSGNFFEDFRLGQVINHATPRTVTSGDVALYTALYGSRFAVNSSAEFAKSIGLGAE
SMGHLAPVDDMLAFHVVFGKTVPDISLNAVANLGYAAGRFGEMVYPGDTITTTSTVIGLK
ENSNKQTGVVYVRSVGTNQLREMVVEYVRWVMVKKRDVSAPAPEETVPDLPGAVAAADLV
IPESLTLGAYDTTLAGSPHLWDDYAAGEKIDHVDGMTIEEAEHMMATRLWQNTAKVHFNQ
YTEGQGRFGRRLIYGGHIISLARALSFNGLGNAFKIVAINGGRHTNPTFAGDTIHAWTEV
LEKIEVPGRKDVGALRLRLVATKNQPCAAHPLKAENGKDFDPAVVLDFDYTVLMPRRK