Protein Info for AMB_RS19965 in Magnetospirillum magneticum AMB-1

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 39 to 66 (28 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details PF01810: LysE" amino acids 16 to 201 (186 residues), 76.9 bits, see alignment E=7.5e-26

Best Hits

KEGG orthology group: None (inferred from 46% identity to tjr:TherJR_1297)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>AMB_RS19965 lysine transporter LysE (Magnetospirillum magneticum AMB-1)
MDPVISFLRGIAIGFAIAAPIGPVGILCIRKALADGRLAAFVAGLGAACADTLFGAAAAF
GIGAVMSFIDGQMVVLKVVGGLFMLGLGLHTWRSAAVSVEAEPGQGPGMLRDFLSTFAIT
ITNPGTIFGVAGVFAALGPMGRPGVGLPTGLLVAGIFGGSALWWLTLSGLASAARNRFTP
ERMRLFNHLSGAMLMVFGVAALGSLLL