Protein Info for AMB_RS19905 in Magnetospirillum magneticum AMB-1

Annotation: KpsF/GutQ family sugar-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF01380: SIS" amino acids 45 to 171 (127 residues), 95.8 bits, see alignment E=1.9e-31 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 45 to 311 (267 residues), 301.8 bits, see alignment E=2.5e-94 PF00571: CBS" amino acids 211 to 256 (46 residues), 22.6 bits, see alignment 1.1e-08 amino acids 266 to 318 (53 residues), 46.2 bits, see alignment 4.6e-16

Best Hits

Swiss-Prot: 51% identical to KDSD_PSEAE: Arabinose 5-phosphate isomerase KdsD (kdsD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 100% identity to mag:amb3933)

MetaCyc: 52% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W088 at UniProt or InterPro

Protein Sequence (321 amino acids)

>AMB_RS19905 KpsF/GutQ family sugar-phosphate isomerase (Magnetospirillum magneticum AMB-1)
MTADSDALAIARRVLDTEARALDSLAASLDGPFLQAVTLIERAPGRVIVTGMGKSGHVAR
KIAATMASTGCPAFYVHPAEASHGDLGMVTRDDAVVALSNSGETPELGDIIAYTRRFEIG
LIGITSRHGSTLATASDVALVLPANPEACPMGLAPTTSTTMMLALGDALAVTLLERKGFT
AADFKVFHPGGQLGQRLLKVADLMHGGDGLPLVGAEAKMAEVLLVMTAKSLGCAGVVTPD
GRLAGILTDGDLRRHMSPDLLTAKAAEVMTASPRTVPPNLLAAEALRQMNERSITSLFVV
EGDGRPVGVLHVHDCLRAGLA