Protein Info for AMB_RS19685 in Magnetospirillum magneticum AMB-1

Annotation: quinone-dependent dihydroorotate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01036: dihydroorotate dehydrogenase (fumarate)" amino acids 11 to 351 (341 residues), 401.4 bits, see alignment E=1.4e-124 PF01180: DHO_dh" amino acids 43 to 334 (292 residues), 295.8 bits, see alignment E=1.6e-92

Best Hits

Swiss-Prot: 64% identical to PYRD_RHORT: Dihydroorotate dehydrogenase (quinone) (pyrD) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 100% identity to mag:amb3890)

Predicted SEED Role

"Dihydroorotate dehydrogenase (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.98.1

Use Curated BLAST to search for 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0D1 at UniProt or InterPro

Protein Sequence (355 amino acids)

>AMB_RS19685 quinone-dependent dihydroorotate dehydrogenase (Magnetospirillum magneticum AMB-1)
MNYFRLAGPLVRLLDAEIAHGLTIGLLKAGLVPRQPTFNPEALKVRLWGRDFANPVGLAA
GFDKNAEVPDAMLAQGFGFVEIGSVTPRPQPGNPKPRMFRLPEDRAVINRMGFNNQGLEA
VAARLAARPRTGIVGANLGKNKDTEDAAADYEKGAARLAPLSDYLVINVSSPNTPGLRAL
QGRDQLESLVGRTRAALTAAMPSGAPPLLLKIAPDLAWEDLSDIAAVALEGALDGLIVSN
TTVARPESLRSANAGQTGGLSGAPLFESSTAMLRRVYELTRGKLPIIGVGGIASGSEAYA
KIRAGASLVQVYSAMVYEGPALITRIKHEMVDLLARDGFKSIAEAVGADHRGQGL