Protein Info for AMB_RS19655 in Magnetospirillum magneticum AMB-1
Annotation: nicotinate-nucleotide diphosphorylase (carboxylating)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to NADC_RHORU: Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Rhodospirillum rubrum
KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 100% identity to mag:amb3885)Predicted SEED Role
"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)
MetaCyc Pathways
- aspartate superpathway (22/25 steps found)
- NAD de novo biosynthesis I (6/6 steps found)
- NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
- NAD de novo biosynthesis III (5/6 steps found)
- NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
- NAD de novo biosynthesis II (from tryptophan) (4/9 steps found)
- nicotine biosynthesis (3/9 steps found)
- superpathway of nicotine biosynthesis (4/12 steps found)
- superpathway of NAD biosynthesis in eukaryotes (4/14 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Nicotinate and nicotinamide metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.4.2.19
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W0D6 at UniProt or InterPro
Protein Sequence (286 amino acids)
>AMB_RS19655 nicotinate-nucleotide diphosphorylase (carboxylating) (Magnetospirillum magneticum AMB-1) MRPEAELDWDDARRVILAALAEDTGADKGGEGEDITSASVIPADLRFTGIMAARHTMVVA GMPVAQEVFRLVVPEARFTARVADGDTVEAGTVLAEMEGPARGLLTAERTALNLLQLLSG IATLTSQYAKRIQGTGCTLLDTRKTIPGLRRLSKYATRCGGAKNHRMGLYDGVLIKDNHI AVCGGVGEAVRRAKAEGRPNIEAECDTLEQVAEAVEAGADIVLLDNMGPDVLRRAVAIVA GRAKTEASGGVTLDTIRAIAETGVDFVSVGRITQSAPAVDIGLDWS