Protein Info for AMB_RS19500 in Magnetospirillum magneticum AMB-1

Annotation: cell division protein FtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 TIGR01174: cell division protein FtsA" amino acids 8 to 379 (372 residues), 378.1 bits, see alignment E=2.4e-117 PF14450: FtsA" amino acids 9 to 193 (185 residues), 36.4 bits, see alignment E=9.4e-13 amino acids 206 to 375 (170 residues), 115 bits, see alignment E=4.4e-37 PF02491: SHS2_FTSA" amino acids 83 to 159 (77 residues), 90 bits, see alignment E=1.6e-29 PF06723: MreB_Mbl" amino acids 199 to 348 (150 residues), 35.6 bits, see alignment E=7.4e-13

Best Hits

KEGG orthology group: K03590, cell division protein FtsA (inferred from 100% identity to mag:amb3853)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0G8 at UniProt or InterPro

Protein Sequence (414 amino acids)

>AMB_RS19500 cell division protein FtsA (Magnetospirillum magneticum AMB-1)
MAARNGLIAALDVGTTKVCCFIAKIQDDGSPRMVGIGHQVARGMRNGTVVDMEELETSIR
AAVEAAEEMANDQVRAVAINISGGHPGSANVKVEVAMNGHAVNEADIRRMLEHGRAHHES
PDRELIHAIPVDYTIDGNEGIKDPRGMFGDRLGVAIHVIAAGIGPVRNLSTVVNRCHLDI
EARVVSPYASGLACLVEDEKELGVTCIDMGGGTTSIAVFLGGQLVHTDVIAVGGAHVTSD
IARGLSTPVVHAERLKTLYGSVIPSASDDREIFKVPLVGEDEDGASNQVQRSMLIQIIQP
RLEETFELVRSHLEQSGFDKLAGRRVVLTGGASQMQGARDLAGQVLDKQVRLGKPIGLHG
LPEATGGPAFSTCAGLIRYALVHAPAPSRGKRTGAGGDGASGWGRLGSWLKRNF