Protein Info for AMB_RS19330 in Magnetospirillum magneticum AMB-1

Annotation: molybdopterin oxidoreductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 PF00384: Molybdopterin" amino acids 61 to 472 (412 residues), 150 bits, see alignment E=9.6e-48 PF01568: Molydop_binding" amino acids 562 to 659 (98 residues), 58 bits, see alignment E=9.5e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3818)

Predicted SEED Role

"Anaerobic dehydrogenases, typically selenocysteine-containing" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0K3 at UniProt or InterPro

Protein Sequence (688 amino acids)

>AMB_RS19330 molybdopterin oxidoreductase family protein (Magnetospirillum magneticum AMB-1)
MTVNTALSVCPHDCPSACPLVVELPEPGRIGRVHGGEMAYTGGVVCAKVARYAERVHHPD
RLTTPLKRVGAKGEGKFAPISWDEALDEIALRLREAADRLGPQTVWPYFYAGTMGHVQQS
AINRLRRIMGYSEQAKTICSTAASTGWMAGTGAKWGVDPREIPESDLIVIWGANPAATQV
HLMGLINQARKQRGAKLVVVDPYRTPTAEKADQHLCLRPGTDGALACAVMHVMFRDDLAD
RAYMARYTDCPERLEAHLQSRTPQWAAAITGLSVDEIEAFARLYGATKRSYLRSGYGYSR
SRNGSVNLHAVSCLPAVSGAWRHKGGGACQSMGGVFDLRRTLLDGLDVPAAPVRILDMSR
IGPVLTHDPKDLAGGPAVTAMLVQNSNPATVAPDSGLVRRGLARDDLFLAVHEQFMTETA
RFADIVLPATTSMEHADLYTSYGHTFLQVAKPVIAPVGESRANHRVIAELASRLGAIHPG
FEMDEWEMIDQVLVASDLPGAEELHVLGGLDCAKVFEDAHFLSGFGHEDGRFRFAPEWKA
EGLPELPDHLAVTDAADEAHPFRLITPPSRHFLNTSFTEMPTSRAQAGRPTALIHPEDCA
ALGAAEGDMVRIGNSKADIIVHAKPLAGIARGVVAVEGIWPDGFFAGGKGVNHLTSADPA
LPGGGAVFHDTKVWLRACHPERERGISA