Protein Info for AMB_RS19255 in Magnetospirillum magneticum AMB-1

Annotation: excinuclease ABC subunit UvrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 TIGR00631: excinuclease ABC subunit B" amino acids 21 to 673 (653 residues), 1011.8 bits, see alignment E=0 PF04851: ResIII" amino acids 31 to 104 (74 residues), 42.2 bits, see alignment E=2.9e-14 PF00270: DEAD" amino acids 34 to 100 (67 residues), 26.6 bits, see alignment E=1.6e-09 PF17757: UvrB_inter" amino acids 176 to 266 (91 residues), 118.5 bits, see alignment E=3.9e-38 PF27431: UvrB_3rd" amino acids 272 to 332 (61 residues), 97.5 bits, see alignment 1.2e-31 PF00271: Helicase_C" amino acids 459 to 562 (104 residues), 67.8 bits, see alignment E=3.3e-22 PF12344: UvrB" amino acids 569 to 610 (42 residues), 67.8 bits, see alignment 2e-22 PF02151: UVR" amino acids 644 to 675 (32 residues), 30.3 bits, see alignment (E = 9.6e-11)

Best Hits

Swiss-Prot: 69% identical to UVRB_ZYMMO: UvrABC system protein B (uvrB) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to mag:amb3803)

MetaCyc: 65% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0L8 at UniProt or InterPro

Protein Sequence (702 amino acids)

>AMB_RS19255 excinuclease ABC subunit UvrB (Magnetospirillum magneticum AMB-1)
MSRPLPFDFMERPPLPEGDVEFKIVSDYQPAGDQPQAIAELSAGVDADERDQVLLGVTGS
GKTFTMAHVIARTRRPALVLAPNKTLAAQLYAEMKGFFPDNAVEYFVSYYDYYQPEAYIP
RTDTYIEKDSAVNEQIDRMRHAATRALLERRDVILVASVSCIYGIGSVESYARMTVALKV
GESIDRSDLLKRLVELQYTRNDAAFERGTFRVRGDAVEIFPVHYEDRAWRLSLFGDEIEA
INEFDPLTGEKTCSLSEVTVYPSSHYVTPRPTITQAIKGIKAELKETLERFHAEGKLLEA
QRLEQRTNFDLEMLETTGHCKSIENYSRYLTGRRPGDPPPTLFEYLPEDALLIVDESHVT
VPQIGGMYRGDFNRKSVLAEFGFRLPSCIDNRPLKFEEWELMRPQTVYVSATPGPWEMER
TGGVFTEQVIRPTGLIDPVCIVRPVEHQVDDLLGEVRQMARLGNRTLVTTLTKRMAEDLT
EYMHDNGVRVRYLHSDIDTLERIEIIRDLRLGAFDVLIGINLLREGLDIPECALVAILDA
DKEGFLRSKTSLIQTIGRAARNIDGRVILYADKMTASLDYALAETNRRREKQQAYNALHG
ITPEGIRKAVSDVMDSVYEADYVTVGTGDSGLAHGVGHNLASVKADIEKRMKAAAADLEF
EEAARLRDELRRLEALDLGIEVNLGTKGRPRSTGKPRGRRRG