Protein Info for AMB_RS19245 in Magnetospirillum magneticum AMB-1

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 13 to 194 (182 residues), 121.3 bits, E=5.8e-39
• PF08659: KR
  • amino acids 15 to 129 (115 residues), 33.9 bits, E=4.5e-12
• PF13561: adh_short_C2
  • amino acids 23 to 247 (225 residues), 117.7 bits, E=9.3e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3801)

MetaCyc: 53% identical to dihydropterin reductase monomer (Agrobacterium fabrum C58)
RXN-23857 [EC: 1.5.1.50]; 1.5.1.50 [EC: 1.5.1.50]; Pteridine reductase. [EC: 1.5.1.50, 1.5.1.33]

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (2/3 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (8/12 steps found)
• tetrahydromonapterin biosynthesis (2/4 steps found)
• superpathway of tetrahydrofolate biosynthesis (6/10 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33 or 1.5.1.50

Sequence Analysis Tools

See Q2W0M0 at UniProt or InterPro

Protein Sequence (259 amino acids)

>AMB_RS19245 short chain dehydrogenase (Magnetospirillum magneticum AMB-1)
MTRDGVSPLLPRAALVTGGGRRIGRAIALDLARQGFAVAVHCHHSAADAQAVRDEITGHG
GRAVVVSADLGREDQVTSLVASAQSALGPLGLLVNNASVFEKDDALGADRASWDLHMEVN
LRAPFVLTQGFARALPPDAEGLVVNLLDQRVWSLTPHFTSYTLSKAALWAATQTLALALA
PRIRVVGIGPGPALPSSRQTEAQFAAQVADLPLARGTSPEEVCRTLRFLLATPSITGQMI
ALDGGQHLGWAVGGTTPDE