Protein Info for AMB_RS18875 in Magnetospirillum magneticum AMB-1

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 212 to 232 (21 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 47 to 592 (546 residues), 530 bits, see alignment E=2.8e-163 PF01368: DHH" amino acids 101 to 257 (157 residues), 71.7 bits, see alignment E=1e-23 PF02272: DHHA1" amino acids 335 to 467 (133 residues), 72.3 bits, see alignment E=8.8e-24 PF17768: RecJ_OB" amino acids 484 to 592 (109 residues), 81 bits, see alignment E=9.7e-27

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 100% identity to mag:amb3730)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0U1 at UniProt or InterPro

Protein Sequence (597 amino acids)

>AMB_RS18875 single-stranded-DNA-specific exonuclease RecJ (Magnetospirillum magneticum AMB-1)
MSHGPSVIHQGPAFLGVERSLSGRRWLARPGDERLAQALAQRLALPELVGRVLASRGIGL
DEAESFLNPTLRDLLPDPGHLKGMDKAVERLVAAVTRGETIGIFGDYDVDGATSSALLRN
ALADMGAKARVYIPDRIKEGYGPNAPALLRLRDEGVAVVVTVDCGTTAFDALETATRAGL
DMIVVDHHVGEAALPAALAVINPNRLDETSPHGHLAAVGVAFLLAVGLNRGLKAAGWYQS
RPAPDLMRWLDLVALGTVCDVVPLVGVNRALVVQGLKVMAKRANVGLAALADVAGVKERP
DSYTLGYVLGPRVNAGGRVGEAELGTRLMSTDNPAEAAEIARQLDGYNKDRQEIEAVVLL
DAIEQVETRPDDGRPLLVAAGENWHPGVIGIVAGRLKERYGRVACVVALEGDQGKGSGRS
VPGLDLGSAIIAARQAGLLRAGGGHAMAAGFTVARDKLTALSDFLAERLQAQLEGDLVPL
LELDGALDAGAAGIELVETLAGVGPFGSGNPEPRFAISGARIAKADVVGSGHVRLILTGA
GGKRLKAIAFRAADSEMGHALLSSAGASFHLAGTLRVDTWQGNSSVQLIVDDAAFAR