Protein Info for AMB_RS18800 in Magnetospirillum magneticum AMB-1

Annotation: LPS export ABC transporter permease LptF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 44 to 70 (27 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 1 to 350 (350 residues), 256.1 bits, see alignment E=2e-80 PF03739: LptF_LptG" amino acids 2 to 350 (349 residues), 237.6 bits, see alignment E=1.1e-74

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 100% identity to mag:amb3714)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0V7 at UniProt or InterPro

Protein Sequence (368 amino acids)

>AMB_RS18800 LPS export ABC transporter permease LptF (Magnetospirillum magneticum AMB-1)
MMRQMLVGMIFVSAALACVLWLTQSLRFVEMIVNKGLSIGAFLKLTILLMPGFLVVIIPI
SLFAVVLFTYNRLIADRELVVLRAAGLSHLALARPAVILGLAVSAVGYMLSCWIIPVTVR
SFHEMQWTIRNDIGNVLLQEGMFNKFGEGLTIYVRSRTPNGELTGLLVHDKRHAQRPVTL
MAERGALVYTEQGPRVLMVNGNRQEVTPGTGKLSLLYFDNYTVDFNTATGAKHDRVRDAR
ERSTLELLAIDSSMENKGELRRFKSELHSRLTSPLYSLGFPLLAAAVLLTSGFDRRGQTA
QVITATALMVAVQALALGASNLSSGNLAFVPLIYINAALPIALGLWVLARPPWPRRRTNA
ASGTATAT