Protein Info for AMB_RS18545 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 TIGR00229: PAS domain S-box protein" amino acids 125 to 250 (126 residues), 31.7 bits, see alignment E=7.1e-12 amino acids 253 to 369 (117 residues), 70.2 bits, see alignment E=9e-24 PF13426: PAS_9" amino acids 139 to 242 (104 residues), 29.8 bits, see alignment E=2.2e-10 amino acids 268 to 362 (95 residues), 55.6 bits, see alignment E=2e-18 PF13188: PAS_8" amino acids 267 to 309 (43 residues), 17.9 bits, see alignment 7.9e-07 PF00989: PAS" amino acids 269 to 350 (82 residues), 44.3 bits, see alignment E=6e-15 PF08448: PAS_4" amino acids 270 to 365 (96 residues), 38.7 bits, see alignment E=3.7e-13 PF08447: PAS_3" amino acids 278 to 355 (78 residues), 36.8 bits, see alignment E=1.4e-12 PF07730: HisKA_3" amino acids 393 to 459 (67 residues), 35.9 bits, see alignment E=3.1e-12 PF02518: HATPase_c" amino acids 498 to 591 (94 residues), 41.2 bits, see alignment E=7.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3665)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W106 at UniProt or InterPro

Protein Sequence (603 amino acids)

>AMB_RS18545 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MGRKRTGGYRVQYRQSRQRRHGILGSPTRMRPLVGQPRLPSSDSLLPCKNGNSLVWIGRG
AEVHIMTTRPGSSKVDKSQDAHRAKAEVQARRNQGESDLLHELRVHQIELEMQNEELRRV
QLELEESRDRYIDLYEFAPVGYVTLGSSGHIESANLTLSSMLGFERSALLKLRFSALVSE
VSGDDWHRFMAAILNDQEDPHRTTDLRLRRRDEGTIEARLDCLRVTNAVHGAMVRVAITD
ITRIKQTEIALQASEKRYSLLAASTFEGIAISAKGRIVDVNEQLVEMLGFPRAELIGRPV
AELISDEDRDRVMDNIHRGHESHIEHGMVRRDGSRIEVEAHGQPFSDDGRAFRLTALRDI
TARKEDEAAARIALHMEHLRNLAIEATLSEERERHSIAKDLHDGLGQTLHLARFKLDRLV
KALPQELPTATLALELIGLLSEASGEVRSLTSKLSPPALKDLGLVAAISWLADEMGRRRG
LQVVVEDDGVPKPLTEGQSTLLFRAVRELVINIAKHAGVGSARIGLRVCNNRLIITVADK
GVGFIDWRATLEARRGFGLSSVRERITFLKGVMDIQTRPGEGTTVVLEMPFDYNDSAPTE
MLP