Protein Info for AMB_RS18345 in Magnetospirillum magneticum AMB-1

Annotation: multidrug ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 10 to 218 (209 residues), 104.7 bits, see alignment E=7.6e-34 PF12698: ABC2_membrane_3" amino acids 54 to 244 (191 residues), 62.9 bits, see alignment E=4.4e-21 PF12679: ABC2_membrane_2" amino acids 65 to 256 (192 residues), 34.9 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to mag:amb3624)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W147 at UniProt or InterPro

Protein Sequence (260 amino acids)

>AMB_RS18345 multidrug ABC transporter permease (Magnetospirillum magneticum AMB-1)
MTGMAPVAYSLAKREFTRFIRQPQRVVGTVAQPLLFWLFLGAGFGGSFRPAGMENVTYLE
YFYPGVMLMMMLFASIFSSITIIEDRDAGFLQGVLVAPVSRLAIVLGKVLGATSIAMIQT
LIFTIAAPFLGLHLGAGSLVLLLMGFLLTGIGFSALGFLLAWGMKSTSAFHAVMMVFLMP
LWMLSGALFPIGNVPAWMKAVMLANPVSHALVIIRAPFYGGPERLFTDTHYLVSLAVTLA
WAGICLGLSMARVNRREKGV