Protein Info for AMB_RS18310 in Magnetospirillum magneticum AMB-1

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 802 PF00989: PAS" amino acids 10 to 100 (91 residues), 35.4 bits, see alignment E=3.3e-12 amino acids 133 to 188 (56 residues), 29.6 bits, see alignment 2.2e-10 amino acids 249 to 355 (107 residues), 53.9 bits, see alignment E=6.2e-18 PF13188: PAS_8" amino acids 13 to 59 (47 residues), 19.8 bits, see alignment 2e-07 amino acids 132 to 182 (51 residues), 23.8 bits, see alignment 1.1e-08 amino acids 249 to 290 (42 residues), 25.8 bits, see alignment 2.7e-09 TIGR00229: PAS domain S-box protein" amino acids 13 to 125 (113 residues), 48.5 bits, see alignment E=9.3e-17 amino acids 133 to 247 (115 residues), 37 bits, see alignment E=3.4e-13 amino acids 245 to 369 (125 residues), 86.2 bits, see alignment E=2e-28 PF13426: PAS_9" amino acids 27 to 117 (91 residues), 38.1 bits, see alignment E=5.6e-13 amino acids 142 to 239 (98 residues), 25.2 bits, see alignment E=6e-09 amino acids 258 to 361 (104 residues), 56.5 bits, see alignment E=1e-18 PF08448: PAS_4" amino acids 137 to 241 (105 residues), 53.8 bits, see alignment E=7.3e-18 amino acids 254 to 364 (111 residues), 39.8 bits, see alignment E=1.6e-13 PF08447: PAS_3" amino acids 271 to 354 (84 residues), 42 bits, see alignment E=3.3e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 370 to 531 (162 residues), 161.7 bits, see alignment E=1.3e-51 PF00990: GGDEF" amino acids 373 to 529 (157 residues), 182.1 bits, see alignment E=2.4e-57 PF00563: EAL" amino acids 550 to 785 (236 residues), 242 bits, see alignment E=2.1e-75

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3617)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W154 at UniProt or InterPro

Protein Sequence (802 amino acids)

>AMB_RS18310 bifunctional diguanylate cyclase/phosphodiesterase (Magnetospirillum magneticum AMB-1)
MSLPAEITDFLGILDESPVGVSVSRRRDGLVLFVNRRFCQITGMTPEQCIGHSARRHFAD
DDQRLEVVRQLKEAGEIADADVKFFRVDGSSFWSVLTIRSATLNGEAVNLAWLYDVSKRK
QAEQAILDGKTLIRAMLDSSTDGIVLVNAEGTILAVNAAASAIFEKNSDDLPGKAIWDHL
PDSVVAPMRRGIDRVLDRRETVESHHAIGAKLFDVHMHLVADSVGQRDRVAIFSRDVTQS
HQRRQQLRKLETALEQAPVSVMITDSHGAIEYVNRAFVLVSGYSEDEVLGRNPRLLKSGE
TVASLYRDMWHCLASGATWQGELCNRAKDGSLFWEYATISPIRDDDGVVTHFMAVKENIT
QRKETEQQLVHQATHDTLTGLPNRLLLEDRVHHAIEVAKREGRRIGLMFLDLDRFKIVND
SLGHVAGDELLKVVSDRLRHTLRRSDTVARLGGDEFVVVLTHFQSTTELAEVAEKISAAL
DEPVELSGHKVHVGASIGIAIYPDDGDNFNALMKDADTAMYRAKQKGRNTFCFYDSNMND
EALDRLKLEEALRRALVRGEFQLFYQPQVDLQTGRTSGVEALIRWNSPERGQVSPALFIP
VAEESNLISMIGWWVLEESCRQIAAWREAGLTGIKVAVNVSGRQFLNHALVECISDLMAQ
YAVLPSQLEIELTESTVMAEPDRAIEQLTRLREIGIQVSVDDFGTGYSSLSYLKRLPLST
IKVDRSFVRDVNNQSDNAAIVSAILGLADALDMSIVAEGVETEGEEQHLKDAGCIKVQGF
RYAKPMPADQLAAWMLRQGRGI