Protein Info for AMB_RS18215 in Magnetospirillum magneticum AMB-1

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 4 to 116 (113 residues), 141.3 bits, E=3.2e-45
• PF02770: Acyl-CoA_dh_M
  • amino acids 120 to 215 (96 residues), 89.5 bits, E=2.6e-29
• PF00441: Acyl-CoA_dh_1
  • amino acids 227 to 375 (149 residues), 187.7 bits, E=2.9e-59
• PF08028: Acyl-CoA_dh_2
  • amino acids 242 to 364 (123 residues), 110.8 bits, E=1.2e-35

Best Hits

Swiss-Prot: 51% identical to ACDB_BACSU: Acyl-CoA dehydrogenase (mmgC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to mag:amb3599)

MetaCyc: 69% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• oleate β-oxidation (27/35 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (7/10 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• valproate β-oxidation (6/9 steps found)
• β-alanine biosynthesis II (3/6 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.1, 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.- or 1.3.99.2

Sequence Analysis Tools

See Q2W172 at UniProt or InterPro

Protein Sequence (378 amino acids)

>AMB_RS18215 acyl-CoA dehydrogenase (Magnetospirillum magneticum AMB-1)
MIATEEQQLIRDMARSFAREKLAPNAARWDREHLFPTDAIAEMGELGFLGMVVPSEWDGA
GTDYVSYAMAVMEIAAGCGPLSTIMSVHNSVGCMPILTYGTEAQKDEFLRPMARGEKLGC
FCLTEPEAGSDAASIRTRARRDGDHYVLSGAKQFISTAKNGQVAIVFAVTDPQAGKRGIS
AFVVPTDTPGFTVVRVEDKLGQHLSDTCQLAFEDMRVPASRRLGEEGDGLKIALANLEGG
RLGIAAQSVGMARSALDHALAYAKERKQFGKPIFEHQAVAFRLADMATRVEVAEQMVLHA
ASLRDAGLPCLKEASMAKLFASEMAERVCSDAIQIHGGYGYLADFPVERIYRDVRVCQIY
EGTSDIQRLVISRALATQ