Protein Info for AMB_RS18010 in Magnetospirillum magneticum AMB-1

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details PF02743: dCache_1" amino acids 57 to 272 (216 residues), 45.4 bits, see alignment E=1.5e-15 PF22588: dCache_1_like" amino acids 198 to 282 (85 residues), 29.2 bits, see alignment E=1.7e-10 PF00512: HisKA" amino acids 355 to 421 (67 residues), 42.2 bits, see alignment E=1.3e-14 PF02518: HATPase_c" amino acids 466 to 572 (107 residues), 73.9 bits, see alignment E=2.9e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3558)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1B3 at UniProt or InterPro

Protein Sequence (576 amino acids)

>AMB_RS18010 sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MPTESFATKGQQCFRRTPGGLRTRLRLLMVAMVVLLLGGAAGLLVELRDAAFEKAESATA
GAARLLEDNLSRTLVTTDAIIARMVVVVQENQAGRIGRAELLRELASLEAGLTQRGNMLV
VDAKGDVVAAVRPPKAGGAVNYAHRDYFSAHRDGAERFIGPMVLGVYSQAPVFTISRRVN
APDGGFGGLVVVGVNARFFTDFYNTLGLGESSYIGANTAGRIMLRQPNPEKYVGRLPPNN
PVMAAAATQPVGTIRIDSPIDKVERVVSYRKLAQFDVLVSAGMAVDDIVAPWRRTALVIC
GALAVVLLGLGWMAGTTFKVISREEQAMASLEETVVARTAEAEQRATEARLANESKTRFL
AAASHDLRQPLQAAGMFVEVLAGQVEDDPRKVKVVDRLRQSIEATNSLLATLLDVSALEA
GKIKPNVSDFRVMPLLAGLVDQIEPEASAKGLAIGVIPTSLTVRSDPVLLERLLRNLLVN
AIRYTTSGRVLVGCRRRGGQVVIQVLDSGIGIPADKAEAVFEDFVRLDTPAERGGSRGLG
LGLGVVRRMAALLGHALELRSIPGKGSCFGVVVSKA