Protein Info for AMB_RS17985 in Magnetospirillum magneticum AMB-1

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 12 to 68 (57 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details amino acids 169 to 200 (32 residues), see Phobius details amino acids 202 to 230 (29 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details PF01925: TauE" amino acids 18 to 286 (269 residues), 159.9 bits, see alignment E=4.5e-51

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to mag:amb3553)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1B8 at UniProt or InterPro

Protein Sequence (301 amino acids)

>AMB_RS17985 sulfite exporter TauE/SafE family protein (Magnetospirillum magneticum AMB-1)
MPHIYLPIAEQSVSILSLLAVGGGIGILSGIFGVGGGFLLTPLLIMLGIPPAVAVASGAN
QVLGSSVSGVFAHWRRRNVDIKMALFLLAGGFIGSAAGVWLFAVLKRLGQIDLVISLSYV
GFLGSVGLLMLVETLLAMRAGAAGRPPGKRHVHHSWHGLPFRTRFPRSGLYISALLPLGV
GAFGGLLAALMGVGGGFILVPMMIYILGMPTAVVVGTSLFQMIFVTANVTLLQAMSTQSV
DLPLALILLVGGAVGAQFGSRLGARLGGEKLRLLLSLIVLAVCAEMTGTLVLPPEDPFSI
E