Protein Info for AMB_RS17885 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 123 to 246 (124 residues), 38.9 bits, see alignment E=4.3e-14 amino acids 250 to 373 (124 residues), 85.6 bits, see alignment E=1.5e-28 PF13426: PAS_9" amino acids 138 to 243 (106 residues), 31 bits, see alignment E=8.9e-11 amino acids 262 to 365 (104 residues), 68.9 bits, see alignment E=1.5e-22 PF08448: PAS_4" amino acids 138 to 245 (108 residues), 30.8 bits, see alignment E=1e-10 amino acids 258 to 367 (110 residues), 34.3 bits, see alignment E=8.4e-12 PF00989: PAS" amino acids 253 to 363 (111 residues), 62 bits, see alignment E=1.8e-20 PF13188: PAS_8" amino acids 254 to 305 (52 residues), 29.5 bits, see alignment 1.8e-10 PF08447: PAS_3" amino acids 276 to 357 (82 residues), 43.5 bits, see alignment E=1.1e-14 PF00512: HisKA" amino acids 387 to 452 (66 residues), 44.9 bits, see alignment E=3.5e-15 PF02518: HATPase_c" amino acids 497 to 606 (110 residues), 97.9 bits, see alignment E=1.7e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3536)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1D5 at UniProt or InterPro

Protein Sequence (607 amino acids)

>AMB_RS17885 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MPWQVGYYAFRWQVRGGCGARRREGRNPSDVHRDQVHRASVMSERRRILILIAVVQTVGL
AALLMLPPGPPAWAVAGLGVALTLVLVARCGRAEGAALQALRAEIGPLRKERDRLSLLSE
VVKESSERYREYSEAAADWFWESDAEQRFTFFSSSFETVMNIMSDDLLGKRSWDIVSERM
EIDSDQWQAHIADLTAQRPFRDFKYWLEDGNGRARWIKVNGLPRFDDDGVFIGYRGTGSD
ITAAVENAHRMHMLNRAVEQSPVSIVITDLNAEIQYVNSSFLRITGYSMDEVIGRNPRIL
RSDTTPPETFQNMWAALSAGEKWEGELINRRKSGELYWEQATIQPIQNIEGVITNYLAVK
SDITEQKKAAAKLAELVEELRRSNEELEQFAYVASHDLRQPLRMISAYLALLEKKLSASF
DQDARDFFGFAIDGARRLDRMIVDLLEYSRIGRITAPMEPVSLGEVVSNALRYLEVAVAE
SGSEVVVPDGLPTISGDGGELVRLFQNLIANAIKYMPEGRQPRIEVLCRAQGAEWVVGVK
DNGIGIPPDDLKRVFGIFQRLVAREQFEGTGIGLAVCRKIAEHHGGRIWVESEMGVGSTF
LVAFPKA