Protein Info for AMB_RS17880 in Magnetospirillum magneticum AMB-1

Annotation: STAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 731 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 328 to 352 (25 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 393 to 425 (33 residues), see Phobius details PF00916: Sulfate_transp" amino acids 11 to 381 (371 residues), 96.1 bits, see alignment E=3e-31 PF01740: STAS" amino acids 461 to 550 (90 residues), 43.3 bits, see alignment E=4e-15 PF00027: cNMP_binding" amino acids 615 to 696 (82 residues), 58 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3535)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1D6 at UniProt or InterPro

Protein Sequence (731 amino acids)

>AMB_RS17880 STAS domain-containing protein (Magnetospirillum magneticum AMB-1)
MTISRQELPAALVAGAVTGLVVVILSLSFAVLIFSGELAGHVGTAIGMALFTAVVVGALV
ALFSSYPGTIAFPQDKIAPILALMASLIVAETPPGTDPEQVFATVASALMLATALTGGLL
FALGYFRLGGFIRFIPYPVIGGFLAGTGWLLVKGAIKVMTGHAPTLEGVPHLFAVAEAVK
WMPGLAFALVLIVGMRRWKHVATLPLLLAGGILGYHLVARLLGQSLEGLEQGGYLLGHLP
AAGGWRPDAVIRALSADWLMIADQAGSVSTILLISAIGVLLNSSGIEVAANQDMDLNREL
KIAGIANLVSGAGGGIIGFHTLGLSSMVLKMGVCSRLVGLISALVCLAMLVIGTEPLALF
PKAVLGGLLMFIGLGFLEEWLVDGRHHMPGADYAIIVMIVAVVGTFGYLQGAAVGIVACV
VLFVVNYSRVAVAKHELTAADVSSNVDRPREEVALLKAHGGRILIYSLQGFMFFGTANKL
LTRVIGRCGDPGPDMVEAVVFDFRRVSGIDTSAAMSFVKLRQFAEKRGLSLVFAGQNAEA
GMVLERAGFVGAEGATWRSAPDLDHALEWSENRLLARLEVEARSKPRSLMADLAEDLGEP
LQVARMMSFVETLDVPAGTVVLQQGSAAHDLFILESGQVTVRLITDNGTSIRLRTMHAGT
VVGEMGLYLNEERSASVVADADCVIHRLTARNLIRMEAEAPSVAAAFHRLMARQLAERLR
NTDHMIRALTD