Protein Info for AMB_RS17835 in Magnetospirillum magneticum AMB-1

Annotation: glutamate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 50% identical to MURI_GEOMG: Glutamate racemase (murI) from Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)

KEGG orthology group: K01776, glutamate racemase [EC: 5.1.1.3] (inferred from 100% identity to mag:amb3526)

Predicted SEED Role

"Glutamate racemase (EC 5.1.1.3)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Peptidoglycan Biosynthesis (EC 5.1.1.3)

MetaCyc Pathways

peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.3

Use Curated BLAST to search for 5.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1E5 at UniProt or InterPro

Protein Sequence (284 amino acids)

>AMB_RS17835 glutamate racemase (Magnetospirillum magneticum AMB-1)
MTSQQRHTVNTSFDAIPVTYPVGIFDSGVGGLTVAAAIRRAMPDERLLYLGDVARQPYGT
KSPRTVTRYAVQAAEFLVEKGIKALVVACNTASAVALEAIAERFPGLPVLGVVEAGADGA
ARASARGRIVVAATEGTCRSEAYERAIARRRDGALVRCVPCPLFVALAEEGLTDGPIVDS
VARHYLGSLFDGTEPGDCLVLGCTHFPLLAPALSRLAGPEVTLVDCAEATSSMLVRLLEG
REAPKGSGGGLHLISTDAPERFARMAGKLFPALGAVPAVELADL