Protein Info for AMB_RS17585 in Magnetospirillum magneticum AMB-1

Annotation: type I secretion system ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 24 to 289 (266 residues), 108.5 bits, see alignment E=7.9e-35 PF00005: ABC_tran" amino acids 356 to 499 (144 residues), 110.7 bits, see alignment E=1.3e-35 PF13304: AAA_21" amino acids 437 to 533 (97 residues), 31.3 bits, see alignment E=3.6e-11

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to mag:amb3475)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1J6 at UniProt or InterPro

Protein Sequence (606 amino acids)

>AMB_RS17585 type I secretion system ATPase (Magnetospirillum magneticum AMB-1)
MSTEKTSWLKTVIEPLRPVMRELLAASLFINLMALAVPIFVMQVYDRVIGHNGTATLKGL
VIGVGVLMAFDWIIRTSRGRIMQTAALRIDVEIGTKLFDKIMHLPLRTLESRPASFWQTL
FRDVDSIRNTVSGSTAVLLTDLPFVLIFLGVIFIIGRPLALVFVVLFVAFLVLAWRSGGA
MKESTGKEKNVQQARDGLVAEIIAGRATVKAVALDRAIRPIWEEKQAGAIEQSIQRGAVN
DEYVNLGQMLTMLGSVALTTVGAVFIMDHDLTMGALVACNMLSSRLYGPINQLVGAWKSF
SSFRQSVDRLGEVFAESEERRHSAIERERPSGLITLEDISFAYDQKSQAAASIDRLEIHP
GGITAVLGRNGSGKTTLLKIILGLYHPAKGRVLLDGADIAQFTRAELAGWMGYVPQECVL
FNASIRDNIVYGAPGASDEDILEAAKVAGVHQYIIDLPDGYGTSIGEAGSRLSAGQRQRI
AIARALLGNPPVLLLDEPSASLDRQAEEDLRTTLAELGKTRTVIIVTHSPVLLPICRDVV
VLDKGCVAAAGPAAETLQRLFGARPPQQPPAQPPHPQSAPQPAPHVVSQPAAPLGGGVRI
GVGGVS