Protein Info for AMB_RS17460 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF00072: Response_reg" amino acids 30 to 140 (111 residues), 31 bits, see alignment E=6e-11 PF13188: PAS_8" amino acids 189 to 238 (50 residues), 22.3 bits, see alignment 2.5e-08 PF00989: PAS" amino acids 189 to 238 (50 residues), 27.1 bits, see alignment 8.9e-10 TIGR00229: PAS domain S-box protein" amino acids 189 to 311 (123 residues), 32.4 bits, see alignment E=8.7e-12 PF08448: PAS_4" amino acids 193 to 305 (113 residues), 36.9 bits, see alignment E=9.8e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 311 to 475 (165 residues), 172.7 bits, see alignment E=5.5e-55 PF00990: GGDEF" amino acids 315 to 474 (160 residues), 152.2 bits, see alignment E=2.7e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3451)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1M0 at UniProt or InterPro

Protein Sequence (477 amino acids)

>AMB_RS17460 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MSKSTDDRTKLSLRRATRPREADGAAPWPVLVVDDDPDVHSMTRVLLRDFSFQGKGFEVI
SAMSGTEARAVLARRADIPVMLLDVVMETPDAGLSLIRHVRDDLGNRRLAIVLRTGQPGE
APERDVMLAYDINDYRSKTELTAQKLFTSLIGGLRSWIYLSTIEAMASTLERRVTERTCQ
LDEARRFAESLVELLPNPLWFTDPDGSLRLYNRAFREMFGVDSGDWHGQPTHGVLPQPLA
GLDQMADMSLKVGGPGGLAFEASLDHQDGQRTLVVNKGLVRSDCRGTADEPMGTIGIVTD
ITERKHMESQLRHLATTDELTGCLNRRAFFVAAEQELERASRYGNAVSVLMIDIDHFKQV
NDRHGHAVGDKALKAATAAIRANLREIDSFGRLGGEEFAAMLPETTLAGALLVAERLRQA
VEAIALPLGDDQPPLRLTTSLGVAERQPGEVAVDQVLARADTALYRAKAEGRNRVLA