Protein Info for AMB_RS17320 in Magnetospirillum magneticum AMB-1

Annotation: MexE family multidrug efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 50 to 380 (331 residues), 261 bits, see alignment E=6.3e-82 PF25973: BSH_CzcB" amino acids 76 to 207 (132 residues), 32.1 bits, see alignment E=3e-11 PF25917: BSH_RND" amino acids 76 to 210 (135 residues), 80.7 bits, see alignment E=2e-26 PF25876: HH_MFP_RND" amino acids 115 to 184 (70 residues), 31.5 bits, see alignment E=6.2e-11 PF25944: Beta-barrel_RND" amino acids 225 to 305 (81 residues), 39.4 bits, see alignment E=2.3e-13 PF25954: Beta-barrel_RND_2" amino acids 246 to 306 (61 residues), 25.3 bits, see alignment E=5.1e-09 PF25989: YknX_C" amino acids 313 to 379 (67 residues), 48.3 bits, see alignment E=2.5e-16 PF25967: RND-MFP_C" amino acids 314 to 370 (57 residues), 23.1 bits, see alignment E=2e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3424)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1P7 at UniProt or InterPro

Protein Sequence (386 amino acids)

>AMB_RS17320 MexE family multidrug efflux RND transporter periplasmic adaptor subunit (Magnetospirillum magneticum AMB-1)
MDHQPRRPKLPLPVLLLGGLALAGVAAGVVSFSSTSSGPAGAPPPAGPAVTVATPASRTI
TDWSEYTGQFAAVDYVEIRARVNGYLTEVHFTDGQLVNKGDLLFVIDPRPYEIALASARA
KLDQAMGTKEYAKRQLSRAGELHRKEFVAESTLDQRTEESRGAGATVEAARAAVRDAELN
LQFTRVTAPISGRIGAKQVSIGNLVTGGPTVASPTLLSTIVSQDPIHVTFDLTEADYLAQ
AKRGNAVGTPVQLRLMSETGWPREGKLDFVDNQIDKGTGTIRARAVLANAEGQVPSGAFG
RVRLATSVPYTSLMVPDTAIVTDQARKLVMTVKDGTVVPKPVVLGPKDGELRVIRDGLAP
DDQVIINGLMRARPGAKVSAQPGKIE