Protein Info for AMB_RS17285 in Magnetospirillum magneticum AMB-1

Annotation: RNA-binding transcriptional accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 787 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF09371: Tex_N" amino acids 17 to 200 (184 residues), 247.5 bits, see alignment E=2.4e-77 PF16921: Tex_YqgF" amino acids 341 to 465 (125 residues), 174.6 bits, see alignment E=3.5e-55 PF12836: HHH_3" amino acids 505 to 569 (65 residues), 89.7 bits, see alignment E=3.4e-29 PF17674: HHH_9" amino acids 575 to 644 (70 residues), 87.5 bits, see alignment E=2.5e-28 PF00575: S1" amino acids 663 to 734 (72 residues), 80.6 bits, see alignment E=2.8e-26

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 100% identity to mag:amb3417)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1Q4 at UniProt or InterPro

Protein Sequence (787 amino acids)

>AMB_RS17285 RNA-binding transcriptional accessory protein (Magnetospirillum magneticum AMB-1)
MTLSLPVATLAAITNRIALELGVKPSQVAATVQMLDEGATVPFIARYRKEATDGLDDTQL
RNLEERLGYLRELEDRRAAILRSIEEQGKLTPDLAGQIGEADSKARLEDLYLPYKPKRRT
KAQIAREAGLEPLADALLADPALVPEQAAEPYVDAEKGVADVKAALDGARQILMERFAED
AELLGNLRDALWDGGVLISTVAEGKSEAGAKFSDYFDYREAIKAIPSHRALALFRGRNEN
VLNLKLLTPDEAARPDGTVSQGPGEFEARIARRFSVRDLKRPADSWLAETVRWAWRIKIH
LHLELELMSRLREAAEAEAINVFARNLRALLLQAPAGARNCIGLDPGIRTGVKVAVTDAT
GKVVETATIYPHQPRNDWQGSVAAIAHLARKHGIKLVAIGNGTASRETDRLVIDVMKRHP
DLGLEKLVVSEAGASVYSASELAAKEFPDLDVSLRGAVSIARRLQDPLAELVKIDPKAIG
VGQYQHDVDQVKLGRSLDAVVEDCVNAVGVEVNTASAPLLARVAGLSPTVARNVVEFRDR
FGPFASREALKQVERLGAKAFEQAAGFLRVVGGVNPLDSSAVHPEAYPVVERIVKATGRP
VKALIGDSSFIRSLDPKEFTDERFGEPTVKDILKELEKPGRDPRPEFKTAAFKEGVETLN
DLKPGMILEGVVTNVTNFGAFVDIGVHQDGLVHISVLADRFVKDPHEVVKPGDLVKVKVL
EVDIKRSRIALSMRMDAQPAPARKDDAPRRDERRPAPQAQQRQPAAPKADEGGGAFAAAF
AKARQKK