Protein Info for AMB_RS17215 in Magnetospirillum magneticum AMB-1

Annotation: molybdate ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 13 to 223 (211 residues), 228 bits, see alignment E=4.9e-72 PF00528: BPD_transp_1" amino acids 27 to 224 (198 residues), 73.9 bits, see alignment E=7.3e-25

Best Hits

Swiss-Prot: 66% identical to MODB_ECOLI: Molybdenum transport system permease protein ModB (modB) from Escherichia coli (strain K12)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to mag:amb3404)

MetaCyc: 66% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1R7 at UniProt or InterPro

Protein Sequence (230 amino acids)

>AMB_RS17215 molybdate ABC transporter permease subunit (Magnetospirillum magneticum AMB-1)
MFTLTPLEMEALRLSLLVSFWAVAASLPLGLGCAWVLARLDFPGKVVVDGIIHLPLVLPP
VVVGYGLLVVLGRRGVVGGWLYDWFGITLAFNWKGAAVASAVIAFPLMVRAIRLALEGVD
RGLEQAARTLGCGPIRTFWSVTLPLMLPGVLTGVILAFARSLSEFGATITFVSNIPGETR
TLPIALYALTQVPGGDEAALRLCVISVVVAFAALLASEYLARRVQARLKG