Protein Info for AMB_RS17175 in Magnetospirillum magneticum AMB-1

Annotation: NADP oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01058: Oxidored_q6
  • amino acids 20 to 166 (147 residues), 103.9 bits, E=2.7e-34

Best Hits

Swiss-Prot: 51% identical to HOXY_CUPNH: NAD-reducing hydrogenase HoxS subunit delta (hoxY) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00436, hydrogen dehydrogenase [EC: 1.12.1.2] (inferred from 100% identity to mag:amb3395)

MetaCyc: 51% identical to delta subunit (Cupriavidus necator)

Predicted SEED Role

"NAD-reducing hydrogenase subunit HoxY (EC 1.12.1.2)" in subsystem Hydrogenases (EC 1.12.1.2)

MetaCyc Pathways

• superpathway of hydrogen production (2/2 steps found)
• hydrogen oxidation II (aerobic, NAD) (1/1 steps found)
• hydrogen production II (1/1 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.12.1.2

Use Curated BLAST to search for 1.12.1.2

Sequence Analysis Tools

See Q2W1S6 at UniProt or InterPro

Protein Sequence (183 amino acids)

>AMB_RS17175 NADP oxidoreductase (Magnetospirillum magneticum AMB-1)
MNAPLPKRKLKVATTSLAGCFGCHMSFLDIDERILDLVELVEFDRSPITDIKHCSPDCDL
GIIEGGVCNAENVHVLHEFRKNCKILIAMGACAINGGLPAQRNSLDIRDILAAVYAQPGR
GVHIPNDPEIPLLLNEVHPLHEVVKIDYFLPGCPPSGDAIWKFLTDLLAGRTPTLGHGLI
HYD