Protein Info for AMB_RS17070 in Magnetospirillum magneticum AMB-1

Annotation: (Fe-S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13183: Fer4_8
  • amino acids 75 to 161 (87 residues), 42.3 bits, E=1.4e-14
• PF13534: Fer4_17
  • amino acids 78 to 162 (85 residues), 37.5 bits, E=4.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3374)

MetaCyc: 73% identical to DsrK DsrC-disulfide reductase (Allochromatium vinosum)
RXN-11924; RXN-21586

Predicted SEED Role

"Sulfite reduction-associated complex DsrMKJOP protein DsrK (=HmeD)" in subsystem Sulfate reduction-associated complexes

MetaCyc Pathways

• sulfur oxidation IV (intracellular sulfur) (5/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (8/12 steps found)

Sequence Analysis Tools

See Q2W1U7 at UniProt or InterPro

Protein Sequence (500 amino acids)

>AMB_RS17070 (Fe-S)-binding protein (Magnetospirillum magneticum AMB-1)
MAAAPFDIPALGDPAEHPIPALKPGAMAASKPYVAAEAHQQPLGFPGELTEGWEKRAVEH
MGSLVSKYRSLQVYMDICVKCGACTDKCHYFLGTHDPKNMPVARADLFRSVYRRYFTPAG
KIAPGLVGARDMTKDVLDEWFNYFHQCSQCRRCSVFCPYGIDTAEISMAARDIMDSIGQG
QKYCNEIIGKVHKIGNNLGLPAPALLDTLEGLEEDMLDDTGVAVKMPIDVEGAEVLLVTP
SADFFAEPHVLGLMGYAKVFHAAGVSWTLSTKASEAGNFGMFIGNYDQMKKISMRIREAA
QELGVKRIIFGECGHAWRVAYSFLNTLAGPWDFLDPRYPVPQHILEFTNDLIERKGIKLD
KSGNDGMVLTVHDSCNVARGARMGDRPGGQFTIPRAVIQASVPKFVDMHPDTICDKTFCC
GGGGGLLTDELMELRVKGASPRMEALKDVVDKQGVTHMAAMCAICKAQFTKILPYYDFDR
EMVVSVHQLVSNAIILGDND