Protein Info for AMB_RS16670 in Magnetospirillum magneticum AMB-1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 268 to 290 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 42 to 249 (208 residues), 71.3 bits, see alignment E=6.9e-24 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 299 to 458 (160 residues), 155.3 bits, see alignment E=6.1e-50 PF00990: GGDEF" amino acids 304 to 456 (153 residues), 143.3 bits, see alignment E=6e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3301)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W220 at UniProt or InterPro

Protein Sequence (466 amino acids)

>AMB_RS16670 diguanylate cyclase (Magnetospirillum magneticum AMB-1)
MRSLSTITWLVVLLLCTAAWSAGAAELTDSDRAYAASLGKVSFCVDPDWEPFEIISPAGQ
HQGIAADLLRLVTGRAGLSLELVPTTDWDESIATSKAGQCTLLSFLNQTPKRDEWLLFTE
PLFTDSNVFITREEHPFIIDPAILSGESIALPSGTSMEERIRRDYPNLRVIITDSEKSAI
DMVSTRQASMTLRSLIVAAYTIRKEGLFNLKIAGQMPNYSNNLRIGVLRDQPRLRDILNK
AIATITPTERGQIINQHVAIQVQTGIDYALTIKIALGLSAVLAVVAYWGWRMRKLSRELD
RLSQTDNLTNLPNRTRLNLQFPIELARARRLGQGLSLIMIDVDHFKRINDEFGHLVGDKV
LIAMADLVRRSVRAIDLPARWGGEELVVLCPDSHLDQALILAERIRQAVRDHDFDTGRRQ
TVSIGVATLGPSDDIDQLLNRADQALYIGKSSGRDRVCSEADLTDT