Protein Info for AMB_RS16145 in Magnetospirillum magneticum AMB-1

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details PF00512: HisKA" amino acids 218 to 283 (66 residues), 60.7 bits, see alignment E=1.7e-20 PF02518: HATPase_c" amino acids 330 to 441 (112 residues), 106 bits, see alignment E=2.3e-34 PF00072: Response_reg" amino acids 475 to 588 (114 residues), 74.7 bits, see alignment E=9.8e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3195)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2C6 at UniProt or InterPro

Protein Sequence (601 amino acids)

>AMB_RS16145 hybrid sensor histidine kinase/response regulator (Magnetospirillum magneticum AMB-1)
MGADDASIDTRVRAEQVRVLARNLPFTALTGTAIALLAALGAAPVAGEMVWWWAGAFVAV
AALRLAMLRFYWTVADRDRRPDFWGPYMAFNLLLSGLMWLIFGLAAFDAHDAGHALFIAV
ILTGLTAASLASLSAYFPGQMAFALPTIAGFVIPVALSGERVMTILAVMAAVFLVVVTLS
CRAAERVLVQSIRLRFENERLIGDLRRAGAEAEAANRAKSDFLAVMSHELRTPIASILGF
VQLAGMAPTLARARAILPKVGRAGRHLLAIVDDILDISRIEAGKYALDLAPFSLDEMLGH
VEDLTRPLAEEKGVELSLQHSDDAPALLVGDALRLGQILINLVGNAVKFTSRGAVHVTVR
TMPIDEISLLLECEVADSGIGIPADRLEAIFEPFTQGDGSTTRRYGGTGLGLSVCRTLVE
MMGGEITVESQPGRGSVFRFSALLGVAGAPQAQTEATESEPALSPDFKALAGRRVLLAED
NPQLAEIYSEFLGMNGIQVIRVENGAQVVPCALDPARRPDLILMDMEMPQMSGLDATRAI
RAHLSRDELPIIGLTAHAFASARDLCFAAGMNDQLVKPVDFHLLTRAIIRTLGAPPADAH
G