Protein Info for AMB_RS15920 in Magnetospirillum magneticum AMB-1

Annotation: HlyD family type I secretion periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 27 to 443 (417 residues), 398.9 bits, see alignment E=1.4e-123 PF25994: HH_AprE" amino acids 105 to 286 (182 residues), 115.4 bits, see alignment E=5.7e-37 PF26002: Beta-barrel_AprE" amino acids 331 to 420 (90 residues), 66.6 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to mag:amb3159)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2G2 at UniProt or InterPro

Protein Sequence (443 amino acids)

>AMB_RS15920 HlyD family type I secretion periplasmic adaptor subunit (Magnetospirillum magneticum AMB-1)
MKFSDIKTELRRLLVLDQSMGEDDVDPIARLMVMALSGALVVFILWASIGQLEVVSVATG
EIAPSSQLKQLSHLEGGIVGEILVAEGDQVRAGQPLLTLQATKSTADLGELSQRLLSLRF
EILRLEAASDSKSEIQFPADLLKQYPDLAKEADAFFRSRRARLASELSGADEQIKQRQQE
INGFRSRIQNDRHSLELLNEQIAISDDLLKKDLQNRFVHIDLLKQASELKGRINEAESAL
SRSNAALAEAHAQKAKVTAAFEEESRTQLDKARREFSELSQRTASFSDNLDRTVINAPVG
GIVKKLYFVTQGGVIRPGAPVIDLVPSDDRLLVEAKLPPQNVGYVKVGDPAYVKLTSPDA
ALFGRLHAKVIHISPDTFTEEKIGTFYKVRLSVERDFFDGGGERYQLLPGVQVAVDIVTG
TRSVMRYLFGPYLRQMSESMRER