Protein Info for AMB_RS15670 in Magnetospirillum magneticum AMB-1

Annotation: preprotein translocase subunit SecY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 24 to 433 (410 residues), 415.4 bits, see alignment E=1.2e-128 PF00344: SecY" amino acids 80 to 422 (343 residues), 394 bits, see alignment E=2.7e-122

Best Hits

Swiss-Prot: 56% identical to SECY_RICCN: Protein translocase subunit SecY (secY) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K03076, preprotein translocase subunit SecY (inferred from 100% identity to mag:amb3111)

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2L0 at UniProt or InterPro

Protein Sequence (447 amino acids)

>AMB_RS15670 preprotein translocase subunit SecY (Magnetospirillum magneticum AMB-1)
MASAAEQLASNLNFGVLAKATELKKRIWFTLLALVVYRLGTWIPMPGVDPHVLGDLFKQS
GGGMLGMFDMLAGGALHRMTIFALNIMPYISASIILQLMTTVIPSLEAVKKEGESGRKKI
NQYTRYLTVVIAVMQAYGIAVGLEGMTSSRGSAVMMDSHLLFRFSTVVTLTGGTLFLMWL
GEQITARGIGQGTSLIIMAGIVAELPAAISNTLELGRTGALPVLVIIGILVMSVAVVAFI
VFMERAQRRIIVQYPKRQVGNKMFGGESSHLPLKVNTSGVIPPIFASSILLMPVTIAQFT
ASGGPEWLTTFTALMGRGQPLYLALYLSLIVFFSFFYTAVVFNPVDTAENLKKYGGFIPG
IRPGKNTSDYLDYVLTRLTVVGAAYLSVLSILPELLISKFSVPFYFGGTSLLIVVSVTMD
TVAQVQSHLLAHQYEGLIKKSRLRGRR