Protein Info for AMB_RS15505 in Magnetospirillum magneticum AMB-1

Annotation: NapH/MauN family ferredoxin-type protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 59 to 77 (19 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details TIGR02163: ferredoxin-type protein, NapH/MauN family" amino acids 56 to 312 (257 residues), 221.3 bits, see alignment E=7.8e-70 PF12801: Fer4_5" amino acids 116 to 153 (38 residues), 29 bits, see alignment 8.1e-11 amino acids 210 to 246 (37 residues), 21.8 bits, see alignment 1.5e-08 PF00037: Fer4" amino acids 293 to 309 (17 residues), 23.7 bits, see alignment (E = 3.3e-09)

Best Hits

KEGG orthology group: K02574, ferredoxin-type protein NapH (inferred from 100% identity to mag:amb3079)

Predicted SEED Role

"Polyferredoxin NapH (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2P2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>AMB_RS15505 NapH/MauN family ferredoxin-type protein (Magnetospirillum magneticum AMB-1)
MKLLSSLKVMLGAAPERPTGYTPEAQAMMDAKRLVKGPEKARQIKAAHAEKHSHKWRNIR
WATLIMVNMIFVLSFRFDVQLVEGALTASRVIGFHFADLNSAIQVMLAYKVILINLVIGT
GTVLFMWWLLGGRTFCSWTCPYHLLAEIAEKIHLALAKRKMVVDYPLHRGSRTVLYVVFA
VLAFVSGYTVFESISPTGIVSRALIYGPGLAMVWVLGLLAYEIIFIRRMWCRYICPIGLT
YGFVGAVSPLRVSYSMENCLHEGDCRKVCLVPHVLECTKKTYADDVKVAIGADCTRCGLC
IDACPTGSLKYEVKGLNKLL